PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009770379.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 589aa    MW: 65449.8 Da    PI: 4.2579
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009770379.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF47.81.8e-151452745
                    HHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  7 snrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    snr   +s+R++g+lKKA+ELSvLCd+++ + +fs+ g+
  XP_009770379.1 14 SNRIGVYSRRKKGLLKKANELSVLCDIDIFLAMFSPGGN 52
                    788889*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.862160IPR002100Transcription factor, MADS-box
SMARTSM004324.4E-16159IPR002100Transcription factor, MADS-box
CDDcd002662.89E-17283No hitNo description
SuperFamilySSF554551.83E-19393IPR002100Transcription factor, MADS-box
PfamPF003191.3E-131456IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-72237IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-73758IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MGRAKLKLHK LDGSNRIGVY SRRKKGLLKK ANELSVLCDI DIFLAMFSPG GNPSVYKSDN  60
SSFEDVITKF AEVNPEERAK RKMECLDTIK KACKKSDHDV DIGQQLCPGD LTTEDINFLT  120
HSLRIRLSDI EGRVRLWKNL EKIDSIQQLR KMEDSISKSL NEIAKHKCGM ASLIFGAGKD  180
FQPSSVRHGI DSPLNSDARK ELHPCSSVHA CDSENIDVYE DMNSFDSFLL CDTGQDFQAS  240
SLMQHGMNLG QELYQCSSVH GENMDVYEDL NSFPLEYLEE QSFSFESYTN LVCNKEIEVS  300
MPESVNFVPG EIFLDCEVNQ EDIVTEFGFT FDVPQLEQMD DKGNAFDCSI NKGSRLPHSD  360
LVNIHDSSKS ASGTCENMIL ADSLHFLYGM DSSSSDAGEE FSTSSSIKHG INLSSTQLDA  420
GLSVNGGDSE NMDDYEDLIA FVSCLKFDDE HGFQSSPSIG QYSMNSPVSF DAGQELHRSS  480
SVNGGDSESI NGYGDLNLFV QGFLDDPSLM IESCTDLACN HEVENYKPGY ENCSADKMFL  540
DCQLNQENIE MAFKSNLDLP LVEQMDVQES SFDCLNKGFG FPLLTSILV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1837210.0AY183721.1 Nicotiana tabacum MADS box protein (Mads1;11) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009770375.10.0PREDICTED: uncharacterized protein LOC104221091 isoform X1
RefseqXP_009770376.10.0PREDICTED: uncharacterized protein LOC104221091 isoform X1
RefseqXP_009770377.10.0PREDICTED: uncharacterized protein LOC104221091 isoform X1
RefseqXP_009770379.10.0PREDICTED: uncharacterized protein LOC104221091 isoform X1
TrEMBLQ84KS10.0Q84KS1_TOBAC; MADS box protein
STRINGSolyc11g045310.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.22e-46AGAMOUS-like 30